SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000017709 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000017709
Domain Number 1 Region: 382-515,831-1005
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.49e-52
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 65-103,152-236
Classification Level Classification E-value
Superfamily PH domain-like 5.07e-24
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 1208-1274
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.29e-18
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 
Domain Number 4 Region: 282-351
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.42e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000386
Further Details:      
 
Domain Number 5 Region: 222-278
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000449
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000017709   Gene: ENSAMXG00000017202   Transcript: ENSAMXT00000017709
Sequence length 1281
Comment pep:known_by_projection scaffold:AstMex102:KB882147.1:1739612:1862869:1 gene:ENSAMXG00000017202 transcript:ENSAMXT00000017709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDEYQCSRSPAWEELQEPRGAAAPPGAVGGAGPADESSDSEGEQEGPQKLIRKVSTSGQ
IRSKTSVKEGLLLKQTSSFQRWKKRYFKLRGRTLYYAKDAKTGGVLARWQYRVSRSRVCW
RVLSVCWSGARRPPPSLGASGSEEGLVAIRSLIFDEVDLSDASVAESSTKNVNNSFTVIT
PFRRLILCAENRKEMEDWISSLKSVQSREHYETAQFNVEHFSGMHNWYACSHARPTFCNV
CRDSLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGIAMPHQWL
EGNLPVSAKCAVCDKTCGSVLRLQDWRCLWCKAMVHTACMDIYPRKCPLGQCKVSIIPPT
ALNSIDSDGFWKATCPPSCASPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLVNGGP
HLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLHKQCQLGVLPLGTGNDLARVLGWG
PSCDDDTQLPQILAKLERASTKMLDRWSIMTYEIKIPPKHSCPATPEEAEDCQFQITDYE
DSVAAHLTKILNSDQHSVVISSAKILCETVKDFVAKVGKSYEKSMENTDEAESMSLKCGI
LNEKLDLLLQTLNTEAQAMRPPSLTTPPIVEEELEEEELQEEEDLSEESLTELKEKLEEN
VTEKDSPHKLFRPREQLMLRANSLKKAVRQIIEQAEKMVDEQNAHTDEQDLQSPTDFKKD
TEDENKDNEKDEDTKELESLPLAKSPCSPTERRVSRSTQSCGSFSMPPFTTSKENLPVLN
TRIICPGLRAGLAASIAGSSIISKMLLANIDPFGATPFIDPDLDPLEGYLEKCVMNNYFG
IGLDAKISLEFNNKREEHPEKCRSRTKNMMWYGVLGTKELLQRTYKNLEQKVQLECDGQY
IPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFCAPSFDDKILEVVAVFGSMQMAVSRVI
KLQHHRIAQCRTVKITILGDEGVPIQVDGEAWIQPPGVIKIQHKNRAQMLTRDRAFENTL
KSWEDKLKYDKPPLRPHLYPQHSVDLATEEEATLIQMCARAAEELITRICEAAKTNGLLE
QELAHAVNAASHAINKTHPKFPESLTRNTAIEVASTVKALHNETESLLVGRVSLQLDPPE
EELLSSALQSVEVELGKLSEIPWLYHILQPNDEEDHSLEYGKRNSRSGMFRIVPKFKKEK
ALKKSSPQSVQRWGTEEVGAWLEQLSLGEYKDTFIRHDIRGSELLHLERRDLKDLGISKV
GHMKRILQGTKDLAKSAMVDL
Download sequence
Identical sequences W5LCZ7
XP_007251765.1.101067 ENSAMXP00000017709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]