SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Astyanax mexicanus 76 > ENSAMXP00000018188

Domain assignment for ENSAMXP00000018188 from Astyanax mexicanus 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSAMXP00000018188
Domain Number 1 Region: 81-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000315
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 135-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000472
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 555-612
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000367
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 682-735
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000106
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 198-259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000315
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 6 Region: 252-321
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000113
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 7 Region: 505-566
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000013
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 8 Region: 619-676
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000131
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 9 Region: 377-432
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000262
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000018188
Domain Number - Region: 326-386
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000119
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number - Region: 29-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00084
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number - Region: 445-500
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00432
Family Complement control module/SCR domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000018188   Gene: ENSAMXG00000017658   Transcript: ENSAMXT00000018188
Sequence length 756
Comment pep:known_by_projection scaffold:AstMex102:KB871753.1:2178556:2200020:-1 gene:ENSAMXG00000017658 transcript:ENSAMXT00000018188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MQVVVKSLIFACFVCYITSENDCQRNDIPFTKILKSALKTSYSSGSIVRVNCETGHVGLL
KLSCQNGTWTKEGGRECKKKPCGHPGDTPNGDFELVGDTEFVFGARVEYTCRTGYIMASR
VNTRICRTQGWDNTIPICEVVRCPPIETPEFVIASGNTEDASYDDVINFECSNNLMLTGP
KDIHCKEDGTWSAPVPKCKAIECKPPKLLHGEIIELKSIYKENEILKYECEKTHKKRQGI
PKCLRNGWSITPQCEEIHCSLGPATIGIERTNPEGKNLFKAEESVEVICAKNYWLSVVKK
PSGWIKCKDNGHWESPPACEDIGCEIPYDQHVYYPEYTFSADRRLGVTKSYSCQSGYKRA
AERAECTMDGWVPNPLCIEKGCLAPTIENTKPLTNPKHKYKIYETVRYQCLPGYEPERFS
INCNWNEQWDNMKSCTAKQGTLLPCNSFRFTHGFMHYLDSDPPSQWVSYSCDQGYKPIEE
GWWGQKSCRQGFVDSKPQCIHSDSCVGLPKIPHAKPSQTDKVFENGAWEYLNCDYGFRIN
PDYTQCVEGQWKPLPQCKRMCGHPPRVENAVVLYIDRQEWNRVTYRCRDGFTMTGQETIY
CTNSEWSTTPRCDLDTNTCRRPTDEINNATIKDTSNVEDYYLHRKTVEYKCSEGFKFKGI
SYARCSQGNWIYPTCIPPGTGACGPPPPIKDAVQEFKDKYEDGEKATYECPAYYVKDGDP
HLTCRQGSWTGSGQCLEPCTVDVHDMDPRNIQLQRG
Download sequence
Identical sequences W5LEC6
ENSAMXP00000018188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.