SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000018414 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000018414
Domain Number 1 Region: 982-1178
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.000064
Further Details:      
 
Domain Number 2 Region: 775-896
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-27
Family Pleckstrin-homology domain (PH domain) 0.0000312
Further Details:      
 
Domain Number 3 Region: 95-119,147-214
Classification Level Classification E-value
Superfamily PDZ domain-like 8.05e-18
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000018414   Gene: ENSAMXG00000017866   Transcript: ENSAMXT00000018414
Sequence length 1505
Comment pep:known_by_projection scaffold:AstMex102:KB871805.1:345349:416236:1 gene:ENSAMXG00000017866 transcript:ENSAMXT00000018414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIPAACPRVCVSEWSFRDAVGVDCSAPEPRCIWVAVLRSDAPNTHTPHTPDVGGGRPSR
APQRVPREIRAKGRRDGTSSSSENPRPVVVGGSDGRGMSWQGPRTLLLQKNSQGFGFTLR
HFIVYPPESALHTSLKDEENGNEKANTGLQRSRLEPMDTIFVKNVRERGPAHQAGLCTGD
RLVKVNGESVLGKTYSQVIALIQNRNDLIQVTVLLKRANLLAQAYSQDAYLRGNEPYKGG
AQCLPPPPPLCYPPRSKSQPPTSHTSCPTSSRVQMGQNQLDNWSRWPGSTSSGPSPPLDN
RITVPAHATVWAAEGRACDPGGVGHSSPAHRTEEIRPPQPTHTPPSSHNERTQQALSNWY
YSQVNEREREKPSVRSLHPRHRSFSQDRLGEFNRTRRTQRSDFPHSVSQDTLLYLQQPAF
NCTRSENLLQTRYGHSGRSLEALDRAPSVLSPCQERPSWGGHQPQSRAEAAPQPQQAMPQ
TRRLPSCQSLDEQPMSMGYRSYSPSFNRKTGRILQHAHSFRDPSYMGPALSWTPTPKTSP
PEGVAPPSAPSPAPPTSSATPTAPEGQDEVVLRQKPPMGRRGGNTNRHPHYGMAIEDDDP
LLFTSDPTEAPPKAESTISQRRSNGNLAPLSVEDDSLASIPFIDEPTSPGVDLRACHVPA
SSVVSSGLKSAPAVAASPASPTFTFPLSRLFSHDCSSIKSSRRSSYLLAITTERSKSCDE
GLNTFRDDSRIFTRLPKRVKSFFGDGSLESLKAAEDARSKRHSTSELGSFNYSDVRREGW
LHYKQIHTEKGKKVGSAMRPWRRVFSVLRCNSLYLYKDKREALLKGSSLGGGSEDEQPIS
IRGCLVDIAYSETKRKNALRLTTQDFCEYLLQAEDRDDMLDWIKVIGESSKTDSEELGFS
RQALINKKLNDYRKQSHTEHPTGNKPDSSPRVPRMNFLLTKPDNSSAPPRSPKHEGKEES
SPPKSPWGINFMKKVKKAGPKAFGVRLEDCQPAASNKFIPLIVEICCGLVEEMGLEYTGI
YRVPGNNAVVSSLQEQLDKGSDINTAEEHQRWQDLNVVSSLLKSFFRKLPEPLFTDDKYN
DFIEANRMENASDRLKTLKKLIHDLPDHYFHTLKFLVGHLKTVADHSEKNKMEPRNLALV
FGPTLVRTSEDNMTDMVTHMPDRYKIVETLIQHYTWFFSEEHDKDEKTPVDTEDVQPAPN
IDHLLSNIGRTGLLGDASVNLTDSTNSDSAKSKGSGGSKRDLSAKDFLTTLSIMSAVARR
RRKRPTANLLGSSTDDDSEQEPIRAGLTAEAEENMPCREESQSVLLSEEEDQRSDAKRPG
GWRGEDARSIVSGYSTLSTLGRSLASEGRGEDADDEQSELVSETDNESGFASRSLTQRLH
SRPSFNSHRLIQCDTLARRRLNTSTTENEGQASIGQTKTQIPNFSLSHSPSSRTKLNPGS
DPESSPAPTLPSEGRFFAPSGATLAEQVRARLLGSAEDLRAASLRKPISPETRRKRRAWR
RHTVV
Download sequence
Identical sequences W5LF02
ENSAMXP00000018414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]