SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000019125 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000019125
Domain Number 1 Region: 1042-1238
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000293
Further Details:      
 
Domain Number 2 Region: 828-950
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-27
Family Pleckstrin-homology domain (PH domain) 0.00000753
Further Details:      
 
Domain Number 3 Region: 42-160
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-18
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000019125   Gene: ENSAMXG00000018574   Transcript: ENSAMXT00000019125
Sequence length 1807
Comment pep:known_by_projection scaffold:AstMex102:KB882137.1:182785:242720:-1 gene:ENSAMXG00000018574 transcript:ENSAMXT00000019125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMETTRRNPDDEDEANYSSPAPLSEDVLEQSKSSAALFQLEDEPFSWPGPKTLRLRRTSM
GFGFTLRHFIVYPPESAVHSVKDEDNDHRGRPRNRLEPMDTIFVKQVKEGGPAHGAGLCT
GDRIVKVNGESIIGKTYSQVIALIQNSETFLELCVMPKDEDILQLFSREITAVAYSQDAY
LKGHDAYSGNARHIPEPPPICYPRVDCKPLGMTEASEATPAPGGPPPDLGYRVEIPVPPS
PPPRVSKQQSAICVCNDSVRTVVVSPDIHMGHLGASVRGDYMGHVGPDAMLMRTRPGTVS
GGRPPYLHARTADVYPSGYHGDSYAIPPTHYSPSASSASIPPGSHQKIDWRTYQTYREYI
DNKGLHAYSRTIQERLDSLRAASQSSHGAAHFAAMPAWGNKIRRRSTSHDRSYQGPPVLP
PRSASQDRMRGTERASRTRDWPPRSVSSDGLIRQPRIVSSDYVEHSDVVVPNMPWHAEWR
GYGRAEQGGTRPSRQSLPQRAVLYSHPAGYGNSVRGRSSAPHQLSSRTDIPPPLASSERI
SRISKNQAKEPPQSKDQRAASAASNHVSVPASLCQQSRARAETMQSPESGKETSVGQRSA
SCSVAPPAQKTHNRDVRGLPPVNGRSPVEGVVLREKPPAGKNASQPLRHPSYILAVNDTD
GAEPAGGVVCWLPNDARREMHMRRLGEQQDSFCSSNLDESLDSIPFIDEPASPSVDHDGS
HIPASAVISTVPAGTSDTSSPKTPSPHMRRQLSHDQESLRNAILEQSGARTERSKSYDEG
LDNYREEGRGRSSKPSLSVFRKALDGYKSSDDSSSRRDSSDIFSDSSKEGWLHFRQLNTE
KSKRVGGGMRPWKQMYAVLRGHSLYLYRDKKEGVAHANSQLDEDPQPVSIKACLIDISYS
DTKRKNVLRLTTSDCEYLFQAEGRDDMLSWIRVIQENSNLDEENAAVTSTDLINRKIKEY
ISMSAPPSKTEPSPKASRQSLSIRHTLLGVTSIKGQSPHSPRNEQERSSKDDSSPPRDKA
AWKRIPGLKKKPQEKKPPAGVTFGVRLDSCPPAQNNGFVPLIVEVCCKLVEERGLEYTGI
YRVPGNNAAISSMQEELDTKGMTDIDIEDDKWRDLNVISSLLKSFFRKLPEPLFTNEKYS
DFIEANRTVNGVERLKVLKRLIHELPDHHYETLKFLSGHLKTVSEHCEKNKMEPRNLAIV
FGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQQYDWFFKEDGDVEPIAPVEQESTVQSQP
VPNIDHLLMNIGRTGQSPGDVSDSATSDSAKSKQGSWGSGKDQYSKELLRSSIFASRKRK
KPKDKTQLSSSDDDLDAVFSNKELQEESDPNWPTDDQTEEAESEVGVGDPLESAEDAEDH
GEGQNSTVAVSSNQQLPSVLIPLQNHPQSIQKTSEFPGLSYRTQMARQNSLSDPPSNYDE
GCISDLGTLNSTSSQASGPRMRRGRIPGNWAENTGAAEVCSITSDYSTTSSMTFLTGVES
SALSPEVRSVAESRGDDDADDERSELISEGRHMETDSESDLSVFATGRDCIPGEEIYLAE
GRATPMQEPPSLIASHRIIACDTLSRKRGSRQKTDSESSTDGGGGGRSEIESVRLSRMLE
PVKSSKSSGSPVLSRSESERERLEPVWRLRITDRLKCRLRSSADDMFGVGSQRTRSPETR
SKRKTNIRRRHTMGGQRDFVELSVIGGWQGSEGAELSAMDRLKPKCSSQDFSITDWIVRE
RHRASNPEVSLDTLDLICAAGPSRSSSSALQMLNGDAATSSQSKNLDAHPHKLSGTQVVR
SRFYQYL
Download sequence
Identical sequences W5LH13
XP_007250678.1.101067 ENSAMXP00000019125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]