SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000020311 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000020311
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.48e-76
Family BAR domain 0.0000000315
Further Details:      
 
Domain Number 2 Region: 302-379
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-21
Family SH3-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000020311   Gene: ENSAMXG00000019716   Transcript: ENSAMXT00000020311
Sequence length 383
Comment pep:known_by_projection scaffold:AstMex102:KB882249.1:799864:845189:-1 gene:ENSAMXG00000019716 transcript:ENSAMXT00000020311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKASQLLSEKISGAEGTKLDEDFMEMERKIDVTNKSVFELLTKTTEYLQP
NPASRAKLGMLNTMSKIRGQVKTTGYPQTEGLLGDCMLKYGRELGDESTFGAALVDVGEA
MKQMGDVKDSLDIGVKQNFIDPLQTLQDKDLKEIGHHLKKLEGRRLDFDYKKKRQGKIPD
EEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLASLIEAALEYHRQSYEILEDLNSKL
QNRIATANSQPRKEFKPKSIMSSLETIDNNQQNGLSYSSSLKSSDHQVTHSVNGKTDHVS
YIPPMTHTWPESPRDKTELHMDQPCCRSLYNFEPENEGELGFKEGDIIILTNQIDENWYE
GMINGESGFFPINYVDVLVPLPQ
Download sequence
Identical sequences W5LKE9
ENSAMXP00000020311 XP_007258203.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]