SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000020395 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000020395
Domain Number 1 Region: 5-147
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-42
Family Pleckstrin-homology domain (PH domain) 0.0000513
Further Details:      
 
Domain Number 2 Region: 353-620
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.48e-38
Family Protein kinases, catalytic subunit 0.00000151
Further Details:      
 
Domain Number 3 Region: 251-396
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-28
Family SH2 domain 0.000025
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000020395
Domain Number - Region: 223-256
Classification Level Classification E-value
Superfamily SH3-domain 0.00738
Family SH3-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000020395   Gene: ENSAMXG00000019793   Transcript: ENSAMXT00000020395
Sequence length 632
Comment pep:known_by_projection scaffold:AstMex102:KB871790.1:30480:66615:1 gene:ENSAMXG00000019793 transcript:ENSAMXT00000020395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMSSTPILEETLIKRSQQKKRTSPLNYKERVFVLTQSRLTYYEGRPEKKFKKGSIDLQRV
KCVEIVKNGGMVIPCQNKYPFQVVYDTNTLYIFAPSNESRSVWVQNMKEEIRNNSLIVAK
FHPQFWQEGGWLCCGQAEKLAPGCEEYNLFGDILRLFPFVCLPVSLFSRKPLPPIPGDES
KTSSDKHIQLLSGSVWSFQILNKHNLNKNNSYIYLNFQQQCKKKRWLTSQEHKEEGYIPS
NYVTLKQPDNLEQFVWYCKNVNRNKAEDQLRNEGKEGGFMVRDSSSPGAYTVSLYTKSLG
DGAIRHYHIKETSGSPKQFYLAEKHLFSSIPEVIDYHKHNAAGLVSRLRYPVNNQNKAAP
TTAGFSYEKWEINPSELTFMKELGSGQYGVVRLGKWRAQHKVAIKAIREGAMSEEDFIEE
AKVMIKLKNLWNIKVLKKVIQKQCVRLVKENMPRCMKTVIKKQVELFHQILISEPHFLFS
AKKNLNDNIFTVFXVFFRLCIPMNSCKFRESGTPVKRYVKDDQYVSSSGAKFPVKWSPPE
VFNFCKYSSKSDVWSFGVLMWEVFTEGKMPFEKNLNHEVVAMVTQGHRLYRPKMATPQIY
DIMQLCWQERPEERPSFTQISLMITDELEADE
Download sequence
Identical sequences W5LKN3
ENSAMXP00000020395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]