SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000021603 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000021603
Domain Number 1 Region: 15-138
Classification Level Classification E-value
Superfamily PH domain-like 9.25e-23
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 2 Region: 457-536
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000148
Family SH2 domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000021603   Gene: ENSAMXG00000020975   Transcript: ENSAMXT00000021603
Sequence length 543
Comment pep:known_by_projection scaffold:AstMex102:KB882196.1:1925857:1943405:-1 gene:ENSAMXG00000020975 transcript:ENSAMXT00000021603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YCSLIPNWNMAAAPISWPNPMRAIGAQNLLTMPGGVSLSGYLHKKGGSQFSLMKWPLRYI
IIHRGCVYYFKTSTSATPQGAFSLNGYNRVMRAAEETTSSNVFPFKIVHFSKKHRTWYFS
AASEDERRKWMRHLRKEINYYTDKKDFHDPGCFSSESDSDAESFYGPIESPLEITEVSDH
PDSGDEEDYLQPDGPTEKKLQNVFITPVRPTAPPPSYPPPPVPNVEDRITPPSTHPKGHL
PPLPPPPNKTPPCPERNKTSLSFPSPPPLLPPLPSKPVLDRFPKPSLPIPSPTYPKKPVA
GRVSGSTLPVCEKRHGSSVVITSPSTLPICRELEEKVVLNTGEKPKPFSIHNNHKLAPKP
EERKPNCSSPIGNKSPNMLPKPPPPGIKPKLGRPSLQRSSPDGQSFRSSVEENPLTKRVR
AKHSDEESDDDYENVQLPDSVFVDTTETNAVEKLFKEAFSSPKDGLYCIRNSGTKTSKVL
VVWDVSLNKARNYRVFEEDSTVFLETDVGFPSLAALVEHYHSHPLPNHGSLCLQQPYGYK
PPR
Download sequence
Identical sequences W5LP40
ENSAMXP00000021603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]