SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000025210 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000025210
Domain Number 1 Region: 28-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-69
Family Ephrin receptor ligand binding domain 0.00000253
Further Details:      
 
Domain Number 2 Region: 636-868
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-60
Family Protein kinases, catalytic subunit 0.0000000405
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 1.6e-33
Family Fibronectin type III 0.00015
Further Details:      
 
Domain Number 4 Region: 904-975
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-17
Family SAM (sterile alpha motif) domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000025210   Gene: ENSAMXG00000024504   Transcript: ENSAMXT00000025224
Sequence length 988
Comment pep:known_by_projection scaffold:AstMex102:KB882101.1:2576204:2825621:-1 gene:ENSAMXG00000024504 transcript:ENSAMXT00000025224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFQLRACIALALVGTVALTDPGHPNQVVLLDTTAVLGELGWTTYPVNGWDAITEMDEQ
NRPIHTFQVCHVMEPNQNNWLRSNWISRQAAQKVYVELRFTLRDCNSIPWVSGTCKETFN
LLYLEAEEPHGPDARFHPADYAKIDTIAADESFTQTDLGDRVLRLNTEIREVGPMARKGF
YLAFQDVGACIALVSVRVYYKKCPSTLRNLAAFPDTVPRVDSSSLVEVRGACVENAEERD
TPKLYCGADGDWLVPLGRCVCSIGHEENDGLCLVCGMFGFHLKQYGIIRCKACGLHVIST
AENSQKCFSLKGVLKQGKNLKSVMCKRPPSPPRNLVYNINETTLLLEWDPPTDTGGRKDM
TYNVVCRRCGGPGQPCDPCDSDVRFVPRPVGLTRPSLAVQDFMANANYTFQIEALNGVSG
MGRAARQVANITISTEQAGPSLVGVVRKDWASQSSIALSWQEADQPHAAILDYEIKYYEK
EQEQLSYSSTRTKVPSAIVTGLKPSTVYAFHVRARTAAGYSSYSPKFEFSTGDEALSTSC
RRSKGAQLALLPSIFNLFAILMPATMFILLKHKPMNSKIRETDSETEGLHFQKGTTMIKS
YFPTNSHNNPKVSVVHQIQAEVFPALEILSVGVCVGEFGEVCGGRLRTPGKKEIPVAIKT
LKGGYTERQRRDFLREASIMGQFDNPNIIRLEGVVTKSKILNMSFYNSGSLESFMLQKHD
GHFTVIQLVGMLRGIASGMMYLSDIGYVHRDLAARNILVDDNLVCKVSDFGLSRVLEDDP
EAAYTTTGGKIPIRWTAPEAIQYRKFSSASDVWSYGIVMWEVMSYGERPYWEMSNQDVRL
HASEPPFEMLVRIPIMQLAISCWSPERAQLALLSLAQGVCELMYQNRVSALSSNKKISSL
PESPEDMPDYPLFISIGDWLDSIKMSQYKNNFIAAGYTTLDSISSMSIEHSDVRRIGVSL
IGHQRRIVSSIQTLRLQLLHIQQSGFHV
Download sequence
Identical sequences W5LQZ2
ENSAMXP00000025210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]