SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000026765 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000026765
Domain Number 1 Region: 502-832
Classification Level Classification E-value
Superfamily L domain-like 1.87e-45
Family Ngr ectodomain-like 0.021
Further Details:      
 
Domain Number 2 Region: 40-430
Classification Level Classification E-value
Superfamily L domain-like 5.29e-37
Family Ngr ectodomain-like 0.006
Further Details:      
 
Domain Number 3 Region: 890-1043
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-34
Family Toll/Interleukin receptor TIR domain 0.0000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000026765   Gene: ENSAMXG00000026060   Transcript: ENSAMXT00000026786
Sequence length 1058
Comment pep:known_by_projection scaffold:AstMex102:KB871578.1:823611:826787:-1 gene:ENSAMXG00000026060 transcript:ENSAMXT00000026786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEMTLLPITVLLLFFQSVWLQSSWYPKSLPCDVIRASNGTEVAVDCTSRSLTRIPAGIP
SNATNLTLTINHIPHIQNTSFQGLDNVTEIDMRCNCVPIKIGPKDHMCTQSVTIDNGSFW
QLKNLKSLYLDGNQLSSIPKGLPPNIVLLSLEVNRISTILKENLTEVPNIQFLYLGQNCY
FRNPCNMSYYIEKDAFFHLERMTLLSLKSNNLSYIPHRLPSSLKELYLYNNNIQQVTEQD
FQNLTDLEILDLSGNCPRCYNAPFPCVPCPNNAPFQIAENAFQNLTKLQILRLHSNSLTV
VNKEWFQGCKQLKVLDLSSNFLGKAITYTSFPHYLPFLEELDLSFNYELQRYPSSLNLSR
AFSHLKSLKILRIRGFVFQELKRQDILPLISLDKLEMIDLGTNFIKITDLSILTELKSFH
IINLSDNKISSPSEGESPGALTMTARGAPDQYFTSPMSRGAQYQSGDVREIHYFRYDEYA
RSCKYRDKEVGTLSPFNTQCSSFGKTLDISRNNIFFLHSRFLNLQELRCLNLSGNAMSQA
LNGSEFAYLKNLQYLDFSRNRLDLMFSTAFQELSNLVVLDISYNNHYFEAEGLTHMLNFT
KNLNKLTKLIMNHNQISTSTNTEMESFSLEHLEFKGNRLDMLWRDGDLRYVNYFKKLMSL
KTLDISRNNLNFIPKQVFQGLPQTLIELNITNNKLKSFNWEFLKYLKNLQVLDLSSNQLK
TVPAKLSNCSKSIVMLVLRKNEIASLTPNFLQDATSLRNLDLSYNQIKYIEESSFPENVI
DNLQVLYLNNNRFICSCNATWFVRWINRTTVNIPRLATDVTCAAPGTQRGQSVIFLNLQA
CQHNYVSIMLSILTTSLILSILTLAISSHLFLWDVWYIYHFCLAKVKGYRRLLPDSTAYD
AFVVYDKTDKAVSDWVMQELRLQLEDRGERRLQLCLEDRDWVPGCPLIENLSESIQLSKR
TIFILTGRFIKSGHFKTAFYLAHQRLLDEKNDVIILIFLEKFSSSHSKYLRLRKRLYKRS
VLEWPRNPRAQPYFWFCLKSVMAAESQQHYNKLFQETL
Download sequence
Identical sequences W5LUE9
XP_007227775.1.101067 ENSAMXP00000026765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]