SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188996402|ref|YP_001930653.1| from Sulfurihydrogenibium sp. YO3AOP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188996402|ref|YP_001930653.1|
Domain Number 1 Region: 18-350
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 4.84e-28
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188996402|ref|YP_001930653.1|
Sequence length 353
Comment cytochrome d1 heme region [Sulfurihydrogenibium sp. YO3AOP1]
Sequence
MRKILLMIMLLITVSFAEEKIYVIERETSSVAVLQDCKFLKRIENLHNLNHAVIKFYENE
GYLITRDGYLIKFDPIEDKVIKEIKVGESSIGFVVTKDYIAVANYSNKSVVILDKDLNII
QTIITDSRNVGIKNYKDYLAFSLMDKDEIWILKKQGNVFKVEKIFKDVGQVPFDAMMEEN
LYIVGFFNSPHIGVLNLDTLEYKKIQLFTEYKEPVLKVPHFGMWTIGKDKIVIPAVGDKK
LFVFDKNFKPIKTVSIYGLPVFTSISPDEKYLAITFSGNEFPYVQILNFETFDTEKILKF
DGKVLHVRWGLDGKFLYISVNDSNKVIRIKRDSWDEDCSVDVIKPSGIFLFSK
Download sequence
Identical sequences B2V826
436114.SYO3AOP1_0458 gi|188996402|ref|YP_001930653.1| WP_012459180.1.9181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]