SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188996405|ref|YP_001930656.1| from Sulfurihydrogenibium sp. YO3AOP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188996405|ref|YP_001930656.1|
Domain Number 1 Region: 120-466
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 5.75e-63
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00031
Further Details:      
 
Domain Number 2 Region: 19-92
Classification Level Classification E-value
Superfamily Cytochrome c 1.58e-16
Family Quinoprotein alcohol dehydrogenase, C-terminal domain 0.087
Further Details:      
 
Domain Number 3 Region: 472-552
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000000000516
Family monodomain cytochrome c 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188996405|ref|YP_001930656.1|
Sequence length 556
Comment cytochrome d1 heme region [Sulfurihydrogenibium sp. YO3AOP1]
Sequence
MLYPAAAVLLNLLFFFLSPVVGEETYNKYCASCHHPQKIGITAPPLLPMTLSKYTDEELT
KIIKNGLSSTQMPSFGNLKDEEIKSIIRFLREDIPINWSIKEIRSSLTLNNNIQKKVLNI
KNIKNITFVVERGHNKIWIMENEDILDAFDFSNVHGGIKYTLDGKNFYIPSRDGWIGYYK
INNKKEGYYVGKIRACINLRNISLSKNGNYLIVSCLLPQTLEILNAKTLEPIKEIQLDGK
ISAIYELYKSDKAIFTFRDKPIIGILNTKDLSINYIKAEEPIEDFFIDPFDKFLIGTSRK
DKKLVVYELEKFKLVFEDKMDSMPHLFSAAFWYKNGKFYFATPHIGKPYISIWQMYDWKF
IKNVEIGSPGFFVKTHPSTDYLWVDNGSDAVVLINKNDFSEKFMTIVKGKKFTHTEFNGN
GNIAYLSIYDNDGYLILYDTKKLQEIKRYPASYPVGKYNFVNKERSFYPSLFGEEIFKEK
CWGCHHQTQEAFGPSFKYIANNRTESQIIAQILDPKNSYKLLGYKRNSMPAFNFNEYEIE
SIVNYIKSFREDKNDR
Download sequence
Identical sequences B2V829
WP_012459183.1.9181 436114.SYO3AOP1_0461 gi|188996405|ref|YP_001930656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]