SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188996406|ref|YP_001930657.1| from Sulfurihydrogenibium sp. YO3AOP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188996406|ref|YP_001930657.1|
Domain Number 1 Region: 116-553
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 9.02e-109
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000135
Further Details:      
 
Domain Number 2 Region: 11-128
Classification Level Classification E-value
Superfamily Cytochrome c 3.87e-20
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188996406|ref|YP_001930657.1|
Sequence length 553
Comment Hydroxylamine reductase [Sulfurihydrogenibium sp. YO3AOP1]
Sequence
MKKLLLTTISTSLALTAISYAQEPDWKLSPEEMQKASQIYFDRCAGCHGMLRKGATGPNL
EPEKTRKMGTEALKAIIHYGTAGGMPDWGASGELTPEETLLMAKFIQNDPPPPPETSLEK
IKETWKVYVPVDKRPTKPMTNRNWKNYMGVVLRDVGKVAIIDGDTKELVNIVNTGFAVHI
LRMSASGRYMYSIGRDGRVTLIDLWMEKPDKVAEVKTCNDARSVDTSKYKGKKGDYLDKY
AVVGCYWPPAIVTLDGQTLEPLKIVSTSNYAYDKPNEFIREARVASIVASHHAPEWVINI
KEAGQVWLYDYSDPLNPKIKQLNAERFLHDGGWDLSKRYFLVAANMRNKVVAVDTEEGKV
AAIVETGVKPHPGRGANIDHPKYGPIWCTGHLGENTIACIGTDPKGHPEYAWKVVKKITL
PGEGGGNLFVKTHPNSKYMYADRPLNPDKEAQSKVYVIDKEKLEVINELKVPEKYLQPKV
VNGKEIKPRGPVHLEFNDKGDEVWVAIWGNKVIPSAILIYDDKTLKLKQAIEGDWVRTPT
GHFNVINTQKDIY
Download sequence
Identical sequences B2V830
436114.SYO3AOP1_0462 WP_012459184.1.9181 gi|188996406|ref|YP_001930657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]