SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|184201241|ref|YP_001855448.1| from Kocuria rhizophila DC2201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184201241|ref|YP_001855448.1|
Domain Number 1 Region: 336-506
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-44
Family Ribonuclease PH domain 1-like 0.000000614
Further Details:      
 
Domain Number 2 Region: 10-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.18e-42
Family Ribonuclease PH domain 1-like 0.000000683
Further Details:      
 
Domain Number 3 Region: 488-587
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-23
Family Ribonuclease PH domain 2-like 0.0000164
Further Details:      
 
Domain Number 4 Region: 153-268
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.63e-20
Family Ribonuclease PH domain 2-like 0.000018
Further Details:      
 
Domain Number 5 Region: 589-700
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.21e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 263-363
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.19e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|184201241|ref|YP_001855448.1|
Sequence length 751
Comment polynucleotide phosphorylase/polyadenylase [Kocuria rhizophila DC2201]
Sequence
MEGPEIQSAEAVIDNGSYGKRVVRFETGRLARQAAGSAMVYIDEETSMLSATAVGKHPRE
GFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDAILTCRLIDRPLRPAFGKGLRNEVQ
VVVTVMSIAPDEIYNTVAINAASMSTTLSGMPFQGPVGGVRMALMAEENGGHQWIAFPKH
SQLENAVFDMAVAGRVVTTKDGGQDVAIMMVEAEATDNAWELIKGQGAVAPSEELVAEGL
EASKPFIKALCDAQADLAARNRKPELDLPRFGGFGDDAAQAVEQFVGERMAQVYSIAGKQ
EREAATDELHHDTLAELTGEGKPFEGRADEVNGAYQALTKQTVRQRILKDKVRIDGRGLT
DIRQLSAEVDVLPRVHGSALFERGETQIMGVTTLNMLKMEQQIDSLSPVKHKRYIHHYNF
PPYSTGETGRVGSPKRREIGHGALAERAITPVLPSREEFPYAIRQVSEALGSNGSTSMGS
VCASTLALYNAGVPLRAPVAGIAMGLVSDTVDGEVQYAALTDILGAEDALGDMDFKVAGT
REFVTAIQLDTKLDGIPASVLASALTQAREARLYILDVLTSAIDAPDEMSEFAPRVISVT
VPVSKIGEVIGPKGKMINQIQEDTGTDISIEDDGTVYIGATDGPSAEAARSAINAIANPQ
VPEVGERYLGTVVKTTTFGAFVSLTPGKDGLLHISEMRQLNDDKRVNEVDDVLSVGQKVQ
VEITKVDDRGKLSLAPVVAGSDSDAASDDEN
Download sequence
Identical sequences B2GKI3
378753.KRH_15950 WP_012398663.1.5541 WP_012398663.1.84478 gi|184201241|ref|YP_001855448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]