SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269793096|ref|YP_003318000.1| from Thermanaerovibrio acidaminovorans DSM 6589

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269793096|ref|YP_003318000.1|
Domain Number 1 Region: 282-415,527-551,742-840
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.26e-17
Family ABC transporter ATPase domain-like 0.025
Further Details:      
 
Domain Number 2 Region: 43-159
Classification Level Classification E-value
Superfamily PHP domain-like 0.000000000000144
Family PHP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269793096|ref|YP_003318000.1|
Sequence length 892
Comment SMC domain-containing protein [Thermanaerovibrio acidaminovorans DSM 6589]
Sequence
MSDTGPMTEALKLPNGARFYRCALQVNPFDYVKRHNKETAFEDEASYNTAIVQACLDHGI
EVIAITDHYRVHTADGLAKAARDAGIHVFPGFEAVTKDGVHILCLFEPGRTTRELERILG
DCGIHRDEAASPTGKYDVIEFLKTATHSWGAVCVAAHVASDGGLLNRLTGQPAINAWTWP
DLLACALPGPVTDAPNGIRQILENKNADYRRDRPVAVINAQDVSSPEDFEKPGASCWIKM
SAVSVEGLRQAFLDPSSRIRLASDPVPEEHEEFLALTWQGGFLDGAAIHFNENLNVLIGG
RGTGKSTVIESLRYVLGLEPLGEDARKAHEGIVRHVLRNGTKISLLVRAHRPAKRDYLIE
RTILNPPIVRDESGNVLEVSPTNIIPQVEVYGQHEISELTKSREKLTRLLERFIDRDATL
AQRKNDLKGKLERIRARIIEVWKEQKEIEDRLATLPALEETLRRFKEAGVEERLKEQTLL
VQEEKVLETAFERLEPFRNLLDQIDRHLPVDRSFLSAEALKKLPGKEVLVEAEQILERFN
EALNTIRAQVANAIRDAEEGLESVKRKWEEREKAVKAQYEKILRELQKSKIDGEEFIQLR
RQIEELRPLRERQAELARNANEYLRQRRNLLAQWEDVKTEEFRELERAAKKVNRKLRNRV
KVTVTFAGNREPLCQLLRDEVRGRLSEALDVLSQRKDLSLVDLANTIQEGKNALCKKYGL
SPSQAERLAQVDPDLVMKIEELDLPSTTTVELNVAPEGEDAQWQTLEKLSTGQKATAVLL
LLLLEANAPLVVDQPEDDLDNRFITNGVVPRLKEEKRRRQFIFATHNANIPVLGDAELIV
GLTASGEAGQGKAKLPSEHMGSIDTLLVRELVEEVLEGGKDAFEMRRRKYGF
Download sequence
Identical sequences D1B6S7
YP_003318000.1.71145 525903.Taci_1493 gi|269793096|ref|YP_003318000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]