SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|560152532|ref|YP_008845387.1| from Lactobacillus johnsonii N6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|560152532|ref|YP_008845387.1|
Domain Number 1 Region: 339-490
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.04e-27
Family HD domain 0.024
Further Details:      
 
Domain Number 2 Region: 228-323
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.41e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|560152532|ref|YP_008845387.1|
Sequence length 540
Comment phosphodiesterase [Lactobacillus johnsonii N6.2]
Sequence
MVNTILVPVAVAIVSVLVGGCAGYSIRKNKWETQAQNAAHDAKHILADAESKAKAVEADL
ASQKEAMKKAAADAKKEKILEAQEEIHHYRERVDNELNERRQEVSRQENRLLQREDAIDH
KDSLLDQKDSQLTQKENQIKKLQAQVLEKENRADQLVTEREKKLYEVAELNQEDAKKIVL
DKLSDQLVKERAEMIEESNQLAKAKADHFARKVIVDAIQSSAADTVSEKTVSVVNLPSDD
MKGRIIGREGRNIRSFEALTGVDVIIDDTPDVVVLSGFDPIRREIAKRALERLIKDGRIH
PARIEEMVDRARKEVNDDIYEAGESALMELGIHKMHPELVKILGRLKYRTSYGQNVLSHS
IEVGKLTGVMAAELGLDEKIAVRAGLLHDIGKSIDHEIEGSHVEIGVELARKYHEPDLVV
NAIAAHHDDVPKLSFIAELVVAADTISSARPGARSESLENYIRRLEQLETIAKGHIGVKQ
AYAIQAGREIRVMVEPDKISDARTTILAHDIRNQIEQDMEYPGNIKVTVIREKRAVAIAK
Download sequence
Identical sequences A0A1B3PTC5 F4AG92 F7SEQ5 Q74KB1 V5P453
LjR32 gi|560152532|ref|YP_008845387.1| WP_004897729.1.13362 WP_004897729.1.24787 WP_004897729.1.27409 WP_004897729.1.46682 WP_004897729.1.54950 WP_004897729.1.65350 gi|42518765|ref|NP_964695.1| gi|385826243|ref|YP_005862585.1| 257314.LJ0840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]