SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291299066|ref|YP_003510344.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|291299066|ref|YP_003510344.1|
Domain Number - Region: 148-246
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000555
Family Psq domain 0.091
Further Details:      
 
Domain Number - Region: 80-104
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0212
Family Intron-encoded homing endonucleases 0.019
Further Details:      
 
Domain Number - Region: 62-113
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0279
Family Di-heme elbow motif 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291299066|ref|YP_003510344.1|
Sequence length 271
Comment hypothetical protein Snas_1548 [Stackebrandtia nassauensis DSM 44728]
Sequence
MHAHLRRRINEFGIDIGHFRRADNTGRPSSRRMSPSELLVRRPDGAKRLDAERLRRALIE
LGTAYECVACGTGREWMGRPLTLHVDHINGEFLDCRRENLRFLCPNCHSQTDTYAGRNRR
RYGGSSLPHVKRTKDAAWVTTESDLAEVFKRVDSGEISVVRAVEQIGCSRGHYYRLRERV
AESRSAAMRKQVRNAAREVRDVAIIEFALDHPELGPKPIAARLSKATDGELRVAHGTVAN
VLRKAGLQYRANREKAAKSRREIEGLDFVTA
Download sequence
Identical sequences D3PW94
gi|291299066|ref|YP_003510344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]