SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291299543|ref|YP_003510821.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|291299543|ref|YP_003510821.1|
Domain Number - Region: 527-604
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0445
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291299543|ref|YP_003510821.1|
Sequence length 633
Comment hypothetical protein Snas_2033 [Stackebrandtia nassauensis DSM 44728]
Sequence
MRKRYLVAAGAALVLATGGTFAFAEPGEPGQAVAKTSAARTVTLPTGDVVKLTGDGNAIW
KPAEGREDKPHLTLTAHDGSDDVITIPSDRLDEIAAGTEDPRRYNVSELLRHGQSDAARA
KTLSGKRYGRYVPIDAEPKQAANDQKVTVSVTDRDGDAPSHLTVVGFVNPATGKTGELEL
DGNGKGTVDLGPGRWDFHTSAFSGNEMIQSVTTVNVKDKPVSALVDGTKAVPVKYQVDRP
AKTQYHSISTDTVVKGGSTFGSGAFAGEGNTGYVIPNDADGIKLEVSSQLLGTDTADPYT
YDLNFLAEDGIPADPTFTAHDAELAQVERTFDGLITTAPTGACNVGFRKDGSGFGNCTPN
EVTWGTTRTEYVTPGPDMTWYAYAFIGDPEADDSIDVTSVAHFEPGPAKAVTGTAPVSFN
VGGQSSVLTRKGDKLNLALPFMDNANRDESIDDLHPVKGELVLTRDGEEIVRKKLTSQSA
EFSLPKKDSGKYTLSAEFKRDKKVTPLATKTKVKWTFKSKPTAKETPLNVSAVSFDADGV
KGGYADVKKPQNFTLDYLPQKGAKDTKLKKLTFEVSYDDGKTWKKVKVKVKGDTATGKLK
HPADAKFVSVRATATDDAGNKATHSTVHSYGLK
Download sequence
Identical sequences D3Q0J2
WP_013017299.1.89426 gi|291299543|ref|YP_003510821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]