SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291300024|ref|YP_003511302.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291300024|ref|YP_003511302.1|
Domain Number 1 Region: 4-70
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000482
Family Tetracyclin repressor-like, N-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 82-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000456
Family Tetracyclin repressor-like, C-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291300024|ref|YP_003511302.1|
Sequence length 190
Comment TetR family transcriptional regulator [Stackebrandtia nassauensis DSM 44728]
Sequence
MKSERARIVADASLEVLAAKGMRGLTHRAVDETAGLAYGSTSNLARTREALLELGLTRLM
EIEADRFSRFPSGDLGQGPEAFAEFAAQSIHLLINEHRRITQARYEMALEATRSPRLRKI
YDEAGVLPRRYTADLLAATGFQDAERRGRVMVSMIDGIIFDAIAGAGGQPSLDELRRTLR
EILEGMWHSG
Download sequence
Identical sequences D3Q634
gi|291300024|ref|YP_003511302.1| WP_013017780.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]