SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291300650|ref|YP_003511928.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291300650|ref|YP_003511928.1|
Domain Number 1 Region: 61-206
Classification Level Classification E-value
Superfamily Sortase 0.00000000000153
Family Sortase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291300650|ref|YP_003511928.1|
Sequence length 208
Comment peptidase C60 sortase A and B [Stackebrandtia nassauensis DSM 44728]
Sequence
MAVCLTLTVIAAAGCGLMLGALTPLPSTSPQPQAVPVPPSVPPVPSLSPGQIAPPGLSRS
TPTVVDIAAIGVHSPVTPVGLDRDGTIEAPDLDQPHQTGWYSHGPAPGQIGTAALVGHVD
SRRSGAAVFYDLGSLETGDSIVVSRRDGRDVTFTVDLVESYPKKKFPYGAVFTNTGYAAL
RLITCGGNFDTKRRSYTHNIVVYATMAT
Download sequence
Identical sequences D3QBF3
gi|291300650|ref|YP_003511928.1| WP_013018406.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]