SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291301089|ref|YP_003512367.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291301089|ref|YP_003512367.1|
Domain Number 1 Region: 71-110,231-267
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000335
Family Cytochrome c3-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291301089|ref|YP_003512367.1|
Sequence length 277
Comment hypothetical protein Snas_3614 [Stackebrandtia nassauensis DSM 44728]
Sequence
MFRINIPIPPPNESNALLARSAAAATHTFNHPDADPQSERTHPAGYLATALMHLSDQLVD
DSAGFANEALPATTLDCVDEFNKAKNQRCPHCHSPYIESRAWHEPCPTCGQPAHSAEPRT
TTLSLTTHLTPPKHTHSIANRNQAEQAANALNAFMVEQSNGHMSPDIQSLLRHDQEVLTI
IVASAFKGIIHLTRSHDLSPAVVMAAAIARYAQDINNETQELRDTPRMRGCLHCEQIVTD
QFRWHEKCQSCRDAHKDVISILRCLTCDNPDECTGHH
Download sequence
Identical sequences D3PWQ2
WP_013018845.1.89426 gi|291301089|ref|YP_003512367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]