SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291301896|ref|YP_003513174.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291301896|ref|YP_003513174.1|
Domain Number 1 Region: 166-341
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 4.97e-28
Family Thiamin pyrophosphokinase, catalytic domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291301896|ref|YP_003513174.1|
Sequence length 396
Comment Thiamin pyrophosphokinase catalytic region [Stackebrandtia nassauensis DSM 44728]
Sequence
MRLPTLRRHDRASDWATGAVGGSAKLDRRTKRLVGRVNCGDIAVVDHMDIDRVAADSLVA
AGVGAVINAKPSISGRYPNLGPEVLVSAGIVLIDEVGDEIFDRIDDGDKLRIEGGKVFRG
EELLAEGRRLDAAAVAAAMAEARQGLAVQLEAFAANTMEYLNKERDLLLDGVGVPEVDTV
FADRHCLIVVRGYDYKADLDVLRPYIREFKPVLVGVDGGADALVEAGYTPDLIVGDMDSA
SDEVLRCGAELVVHAYSDGHAPGMTRLEHLGVAAKVFPASATSEDIAMLLADEKGASMIV
AVGTHATLVEFLDKGRSGMASTFLTRLRVGAKLVDAKGVSRLYRQRVPASGSFLLACSAI
AGVAAAVALFTAGMSFAETGADWWDGMVSAIQRIFS
Download sequence
Identical sequences D3Q532
WP_013019652.1.89426 gi|291301896|ref|YP_003513174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]