SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291302014|ref|YP_003513292.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291302014|ref|YP_003513292.1|
Domain Number 1 Region: 168-445
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-40
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 553-656
Classification Level Classification E-value
Superfamily TPR-like 0.0000000938
Family BTAD-like 0.098
Further Details:      
 
Weak hits

Sequence:  gi|291302014|ref|YP_003513292.1|
Domain Number - Region: 128-164
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0167
Family Cytochrome c3-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291302014|ref|YP_003513292.1|
Sequence length 776
Comment serine/threonine protein kinase [Stackebrandtia nassauensis DSM 44728]
Sequence
MNSSPCTQPGCSGSYGPEGYCDVCGSRNPQAVAPQPTSAPPVSGAPVSAQQVSAPPTSAP
PSTVSSGPVTAAGSQATQTSGSRATRATGTQPFSSTSRSRFGGGMTDIPPVPIRDPNEAV
LDNPQVPEHKRNCSKCHKPVGRTGPDGKPGRTQGFCPHCRNRFSFVPSLVQGDMVAGRYE
ILGAMAHGGLGWIYLARDKNIGDDVAERWVVLKGLIDSSDPDAIDSAIAERRFLAALDHP
NIVQIYDFVRHPDPRTNEPLSYIVMEYVPGKSLRDLRKEYVDETGVHSPLPLSQVLTYLV
EILPALGYLHGQGLLFCDFKPDNVIHVESWLKLIDLGAVRRLDDDESAVFGTPGYAVSDD
EIINHGPSISSDLYTVARSAAVLSFEFGNFSRGEFRNKLPGPQTQPLLARFESYRRFLER
ATDPEPSRRFATAAEMREQLIGVRQEVLSLERAYPHGNSSVLFTPEQRHFGVPDARTGEF
TAPRGPDIATALPYPFVDSDDPSAGFLATLSATDPMDILYELQNAPENSAEVRLRRVRAN
IAYGNLKAAGMNLDQYAETGTGDWRITWWRGVIGLLSDNPAEARGHFDALYSHLPGEIAP
MLALAAACELSGDTTAALGLYSRIWQTDRRYVSAAFGQSRLLARDGHADPAIHVLDAVPD
SSSQYTTAKVATIALRLASAAGPDFVRDAAQRLTGLDLPEHHHHLLRARILLACLRHVNG
AQGVPSPPILEHPLEEKALRFGLEETYRRLARTSSARDDRIRFIDEANKIRPWTMV
Download sequence
Identical sequences D3Q6F6
gi|291302014|ref|YP_003513292.1| WP_013019770.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]