SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291302412|ref|YP_003513690.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291302412|ref|YP_003513690.1|
Domain Number 1 Region: 40-324
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.32e-26
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291302412|ref|YP_003513690.1|
Sequence length 357
Comment hypothetical protein Snas_4958 [Stackebrandtia nassauensis DSM 44728]
Sequence
MNRVLKRHVLPVCVATASLAAITLATPAHAHDGFKASNLSWQLTDTGVDNQFRGLAAVDD
DTAWVAGTKGTVLRTTDGGDSWDNVSPAGAEGLEFRDIEAYDDEHAVALSIGEGEASRVY
VTDDGGDSWHNSFTNAEPKAFYDCMAFFDAKHGVAMSDPVDGRIRFITTDDGGHSWDMLP
PERSPEALAGEFAFAASGQCLVAADKRNGYLVTGGGETARVIHTPDRGQSWEAHDTPVAS
GPSAGIYAAAFRDTKRAILVGGDYTTPDAVKDAAAYTRKGVENFALSPGEPGQYRSSVAY
VAGSIAITVGPTGSDLTVDNGRDWHRFDDGAFDSVECAKFACWASGPKGRIATLELG
Download sequence
Identical sequences D3Q9Q1
gi|291302412|ref|YP_003513690.1| WP_013020168.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]