SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291303070|ref|YP_003514348.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291303070|ref|YP_003514348.1|
Domain Number 1 Region: 85-221
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.54e-23
Family GntR ligand-binding domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 13-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.74e-19
Family GntR-like transcriptional regulators 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291303070|ref|YP_003514348.1|
Sequence length 240
Comment GntR family transcriptional regulator [Stackebrandtia nassauensis DSM 44728]
Sequence
MTNPITGLGASIQRQSTTEQAADAVRQAILSGRLLPGTPLRETALAAELGVSRSTLREAA
RTLDGEGLVRYQMNRGIVVADITGQDVTDIYAARAAVELAAVDALSEHRDPAIYAKLADL
VDQIEGAFDDGDTTAALEGDRLFHATLVTATGSPRLCRFYQQLQQEQRLALALAERSRRE
LGRTTDDHRQLLDALHGSAEQARTELTAHLRAGAAELRRLLDLLTQRQQSTRREETKDSA
Download sequence
Identical sequences D3PX31
WP_013020826.1.89426 gi|291303070|ref|YP_003514348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]