SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261404817|ref|YP_003241058.1| from Paenibacillus sp. Y412MC10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261404817|ref|YP_003241058.1|
Domain Number 1 Region: 38-431
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.5e-110
Family Amylase, catalytic domain 0.000000000000609
Further Details:      
 
Domain Number 2 Region: 610-712
Classification Level Classification E-value
Superfamily Starch-binding domain-like 8.83e-35
Family Starch-binding domain 0.00000159
Further Details:      
 
Domain Number 3 Region: 434-520
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.36e-27
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000114
Further Details:      
 
Domain Number 4 Region: 525-604
Classification Level Classification E-value
Superfamily E set domains 1.71e-16
Family E-set domains of sugar-utilizing enzymes 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|261404817|ref|YP_003241058.1|
Sequence length 713
Comment alpha amylase catalytic subunit [Paenibacillus sp. Y412MC10]
Sequence
MKKFYKLTTALALSLSLALSLLGPAHAAPDTSVSNKQNFSTDVIYQIFTDRFSDGNPANN
PTGPAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSVINYSGVN
NTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAE
NGKLYNNGTLLGGYTGDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDTYLKD
AIKMWLDLGIDGIRMDAVKHMPFGWQKSFMATVNNYKPVFTFGEWFLGVNEVSAENHKFA
NESGMSLLDFRFAQKVRQVFRDNTDNMYGLKSMLEGSAADYLQVEDQVTFIDNHDMERFH
NNSANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGNDPDNRARIPSFSTSTTAYQVIKK
LAPLRKSNPAIAYGTTQERWINNDVLIYERKFGNNVAVIAVNRNVNTPASITGLVTSLPA
GSYTDVLGGLLNGNSLTVGSGGSASNFTLAAGGTAVWQYTTAVTTPTIGHVGPMMAKPGA
TVTIDGRGFGATKGTVYFGTTAVTGANITAWEDMQIKVKIPAVAGGIYNIKITNSAGVSS
NVHDNFEVLTGDQVSVRFVVNNATTALGQNVYLAGSVSELGNWDPAKAIGPLYNQVIYQY
PTWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPTSGTATINVNWQP
Download sequence
Identical sequences D3EF40
481743.GYMC10_0953 WP_012819102.1.35877 gi|261404817|ref|YP_003241058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]