SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261405172|ref|YP_003241413.1| from Paenibacillus sp. Y412MC10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|261405172|ref|YP_003241413.1|
Domain Number - Region: 17-112
Classification Level Classification E-value
Superfamily E set domains 0.00462
Family Arrestin/Vps26-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|261405172|ref|YP_003241413.1|
Sequence length 257
Comment SpoOM family protein [Paenibacillus sp. Y412MC10]
Sequence
MSFFNKMLASVGIGAAQIDTHLEKSSYYPGEEVRGIIHIKGGNVEQTVDRIYLKLMTEYT
RESDDKKYIESYTIAKVNVSSRLTLKPGDQQEIPFAFPLPLETPLTISRQPVWIHTGLDI
DNAIDPKDRDFIDVEPNEDASIVFDAVESLGFSFKIATCEYHPRLGQGVPFVQEIEFYPG
SSYAGHIKELELILYPEQEGISILVEVDRRGRGVSGWLQRSLDMDEQHSWVTLDKQDLAQ
GPSHVAQILDRVIRRSI
Download sequence
Identical sequences D3EJD4
gi|261405172|ref|YP_003241413.1| WP_015733829.1.35877 481743.GYMC10_1319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]