SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261405748|ref|YP_003241989.1| from Paenibacillus sp. Y412MC10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|261405748|ref|YP_003241989.1|
Domain Number - Region: 50-89
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.00144
Family Copper amine oxidase, domain N 0.017
Further Details:      
 
Domain Number - Region: 95-160
Classification Level Classification E-value
Superfamily E set domains 0.0168
Family Filamin repeat (rod domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261405748|ref|YP_003241989.1|
Sequence length 184
Comment hypothetical protein GYMC10_1900 [Paenibacillus sp. Y412MC10]
Sequence
MKWKKVMACMLVLSLMGGSTLLFADSVNERVRVWLNGRELKDGGYLIDGKTYVPVREFDG
AVDWNSANGQVQVVKPNVHIFLFKGDTVFGNVNKGKLKFNVFSQVDSLNNNIHAVKVAIE
DPSGNIKDIQSQEVKDRKDNFWFRTYDFTYDFKTAGKYSVGFYVKVKSDDGFVKVAEKVI
TALN
Download sequence
Identical sequences A0A1H7XXK9 A0A2A5LPY2 D3E5N2
gi|261405748|ref|YP_003241989.1| 481743.GYMC10_1900 WP_015734300.1.24093 WP_015734300.1.35877 WP_015734300.1.3965 WP_015734300.1.52352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]