SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289595939|ref|YP_003482635.1| from Aciduliprofundum boonei T469

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|289595939|ref|YP_003482635.1|
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily EF-hand 0.000444
Family S100 proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289595939|ref|YP_003482635.1|
Sequence length 46
Comment hypothetical protein Aboo_0261 [Aciduliprofundum boonei T469]
Sequence
MIIMDRVLEIFDKWMAYELYKDGTMSKNEFLKIMNFEKYHTAKMPS
Download sequence
Identical sequences D3TBY8
gi|289595939|ref|YP_003482635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]