SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289596337|ref|YP_003483033.1| from Aciduliprofundum boonei T469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289596337|ref|YP_003483033.1|
Domain Number 1 Region: 13-277
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 5.59e-61
Family Lambda integrase-like, catalytic core 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289596337|ref|YP_003483033.1|
Sequence length 284
Comment integrase family protein [Aciduliprofundum boonei T469]
Sequence
MSDKFMDYVDYELEKFKEYLRGEKRSENTIKEYAHFISDMLRYFHKRAEDITPGDLNKYK
MYLSTKRKYSKNSLYLATKAIRSYFKYKNLDTAKNLSSPKRPRQMPKYLSEDEVKRLIEA
SSENPRDYAIISLLAYSGLRVSELCNLKIEDVDFNERIVYVHSGKGDKDRIVVVSPRVIE
ALQNYLYTREDDMEYLFASQKSNKISRVQVFRIVKKYAEKAGIKKEVTPHVLRHTLATTL
LRRGVDIRFIQQFLGHSSVATTQIYTHVDDALLKSVYDKVLQEY
Download sequence
Identical sequences D3TD36
gi|289596337|ref|YP_003483033.1| WP_012997197.1.69060 WP_012997197.1.72259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]