SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289596596|ref|YP_003483292.1| from Aciduliprofundum boonei T469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289596596|ref|YP_003483292.1|
Domain Number 1 Region: 47-98
Classification Level Classification E-value
Superfamily EF-hand 0.0000971
Family Calmodulin-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289596596|ref|YP_003483292.1|
Sequence length 530
Comment binding-protein-dependent transport systems inner membrane component [Aciduliprofundum boonei T469]
Sequence
MIKKIIIVLFIISILLIPSIHAKNSNINSEIKDRYSGHIFIKQIFSPQLKKEYDKDHSGY
LDFSEFLKLLDENMMKLNFTPAGNYFLIFHNLTIDGRNPIVNLKGIHKYENYSFPMPVNT
SSYYAISFNFTFYLNGTYDHTLKISLPDVSGMFSIALPKNDTILQSNLIDSITEKNKIKG
RFDSSIIIKFREEYYYRMSIYAYSFLAALIGVFVFIAYKFRGGRVKGIKLLIRSTLRNLF
ALFIVLTILFYILWVFGPPPQVRVGGISDIVMRFYIIKYYHLDRPWYDQYLNWWHLILTG
GITKGVNWGTQPIDLKNAIIVSLTIFILTTVITYFSSLYLAIRKKSPRSLDIYAAIFLAL
YSIPTFYASLVILQTFQNWPLLYDALVSPTNGWQEGIRIIIASLILSLLTIARPYLIAHS
IANREYMEPYVKTFQAVGLTPKRIKKFIKKSTMIPTMTDLVLNFGWILTAQVFLEVIFHI
KGIGLILFKGTINGNPFQIQIAIIYFSLVMIAASIFSDIVIYFLDPRVRR
Download sequence
Identical sequences B5IDB6
WP_008084310.1.69060 WP_008084310.1.72259 gi|289596596|ref|YP_003483292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]