SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289596891|ref|YP_003483587.1| from Aciduliprofundum boonei T469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289596891|ref|YP_003483587.1|
Domain Number 1 Region: 50-334
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 2.38e-36
Family Lambda integrase-like, catalytic core 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|289596891|ref|YP_003483587.1|
Domain Number - Region: 2-46
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0994
Family Exocyst complex component 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289596891|ref|YP_003483587.1|
Sequence length 355
Comment integrase family protein [Aciduliprofundum boonei T469]
Sequence
MNIRKIKEVVDEVSKALENGNYEDARDLIENLRAMLKSTTESKGWQKNKDEYFAYLKTTR
EIKTVKDHRIKLEKAEEFLKEKYGYLPNPASITEKDAREYLYWLKLKGYDRNYYRRVFQV
FIQFLAFSMNPRAFKMRFLVPREDKKPILYMAVEDVKKALEMFGEQNFEELKHRTMIWIY
AWTGIRYSEVIVLKKDDIDLKNNLIIVREGKGGHERVVYIPPVLKGLLEKYIERWEKYMK
LREEMGLRTSEYLFFWIKRNGEIMDPYWGFRGYFTHFADRAKEVGIEKFNIKKFRATIAK
LLREIGGVDLSTVSAQLGHSRTSTTEEFYHRMGPVGLEKPYEKVEKLLLGDKKDD
Download sequence
Identical sequences B5ICF0
WP_008083947.1.69060 WP_008083947.1.72259 gi|289596891|ref|YP_003483587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]