SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284163402|ref|YP_003401681.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284163402|ref|YP_003401681.1|
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.91e-33
Family Imidazole glycerol phosphate dehydratase 0.00024
Further Details:      
 
Domain Number 2 Region: 89-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.4e-28
Family Imidazole glycerol phosphate dehydratase 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284163402|ref|YP_003401681.1|
Sequence length 196
Comment imidazoleglycerol-phosphate dehydratase [Haloterrigena turkmenica DSM 5511]
Sequence
MSERTATRTRETAETSIELELAIDGDGEADVDTGIGFFDHMLTSFAKHGLFDLTVDCDGD
LEVDDHHTVEDVAIVLGEAFDEALGDRSGIVRYADRKVPLDEAVAGAVVDVSGRPRFYFD
GAFSQAQIGDFTSDMARHFGESLAMNAGLTVHLEVVSGENAHHEVEALFKALARTLDDAT
RFDEHREGTPSTKGTL
Download sequence
Identical sequences D2RTG5
gi|284163402|ref|YP_003401681.1| WP_012941340.1.92728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]