SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284163406|ref|YP_003401685.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284163406|ref|YP_003401685.1|
Domain Number 1 Region: 3-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-35
Family YigZ N-terminal domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 154-215
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000528
Family YigZ C-terminal domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284163406|ref|YP_003401685.1|
Sequence length 216
Comment hypothetical protein Htur_0111 [Haloterrigena turkmenica DSM 5511]
Sequence
MSRSYRTVAKAATADFVVQGSEFIGRVRPVDSVDAAESFVDAVSEEYADATHNVPAYRVR
VGDESGENGGRTEDAAGTGHFLREYSSDDGEPSGSAGKPALNVLTQQEIENCAVVVTRYY
GGTNLGVGGLVRAYSRAVKEAVEAAGVIEERPHETVSITVEYDDSGTVRGILESEGYEFE
ADYQADVSFDVRVPLEEADAFRDRLRSATSGRADLE
Download sequence
Identical sequences D2RTG9
gi|284163406|ref|YP_003401685.1| WP_012941344.1.92728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]