SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284163917|ref|YP_003402196.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284163917|ref|YP_003402196.1|
Domain Number 1 Region: 831-882
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000049
Family Type I dockerin domain 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|284163917|ref|YP_003402196.1|
Domain Number - Region: 696-808
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00046
Family Cellulose-binding domain family III 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284163917|ref|YP_003402196.1|
Sequence length 884
Comment hypothetical protein Htur_0625 [Haloterrigena turkmenica DSM 5511]
Sequence
MVEFTRRKLMASSAAAAVGAGTVGLAGADEDPEEHDTLEAPYVKGNIDRFSTTAFGAEVT
GPFVFDTGELLYSLQGPHDDNLEPFNAGGVGVFDDFRFTFNGKNDEFDELEPPRTDREEQ
QVLSAAGEYRLLVQTGDPINGGTERFGHPQTPDGTELVEVSEDGYGIGDQADMNFFVSTD
EEGLEGYLFTNNEIRPGGITRTPLYRDEDGYLQADLENAMELENTEVFREIGGTKVNCYG
DLSPWETPLSAEEEYGHPRVNGLATVSDIVEAGSGVGLRGGSEFWNRPDILEVDGSLREL
FGDEHEYPMGLHNNRNTEKHAYHLGVEPRDQNEVEGEDGPETVNTPRPIGDEEFPNRYRY
GKIVEVTEPTADVPTPVKHHVFGRAAWECPEVLPDERTVYLASDGGAKGIYKFVAEEPIP
EYDDRMDVRGTLYAMKAAEIGEGPVAETDLDVEWLSLGTASNAEIESWISDYDDVTQVDY
LETHAETDWADDLEQALMEADEEVAINGNQDYITDEEVVEWAAQYEERGPDGVDEELRRV
PFLETRAAAKEIGASVEFNKAEGIDAHDEAEPGDFIYFGISSLGGTMTDKYGDLRFDEVQ
TGVLYRAELEEDYNVSRLEPVVVGPNESDPTSILDESLINVDNVMVMDDGRVLLCEDKGT
FGRTYENDALWVYEPPAVLEASSVAVSHGATGEVNLTLSSIPDGLAGGRVTVSVEHADVA
AIADASYHDALELTSGPSIDGDGSSVEFRFADLEDEIGATLDDVTLATLDLEGVGTGTTD
VTIEVHSLDDDDGLAIDTQARPGVVVVGPPPVGEGSGSGRAPTDLDGDGLFEDVNGNGRL
DYQDVTLLFEHLEDDAVQLNEAAFDFNDNGRIDYDDVVALYDEL
Download sequence
Identical sequences D2RWD4
WP_012941844.1.92728 gi|284163917|ref|YP_003402196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]