SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284163918|ref|YP_003402197.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284163918|ref|YP_003402197.1|
Domain Number 1 Region: 830-881
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000115
Family Type I dockerin domain 0.0049
Further Details:      
 
Weak hits

Sequence:  gi|284163918|ref|YP_003402197.1|
Domain Number - Region: 699-809
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000439
Family Cellulose-binding domain family III 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284163918|ref|YP_003402197.1|
Sequence length 883
Comment hypothetical protein Htur_0626 [Haloterrigena turkmenica DSM 5511]
Sequence
MVEFTRRKLMASSAAAAVGAGTVGLVGADEDPEEHDSLEAPYVKGNIDRFSTTALGAEVT
GPFVFETGELLYSLQAPSDDNMEPFNRGGVGVFDDFRFTFNGKNDEFDELEPPRTKTEEQ
QVLGAAGDYRLLVQAGDEINGGTERFGHPQTPDGENVAELAGEDLASAGGVTDMNFFVST
NEEGTEGYLFTNNETRPGAIIRTPLSRESGRWEADLENAMELENTEAFREVGGTRINCYG
DLSPWETPLSAEEDYGHPRVNGLATVSDVVEAGSGVGIRGASTFWNRPNVAGIEDALADI
FGEDAWYPMGLWALTGLEKHAYHLGAEPVDLREFENEDGEIEIEDRRRPIGDEAFPNRYR
YGKIVEITDPASDDPTPVKHHVFGRAAWECPEVLPDERTVYLASDGGAKGIYKFVAEEPI
SEYDDRMDVCGTLYAMKATEIGEGPVAETDLDIEWLPLGTASNAEIESWISDYDDVTQVD
YLETHAETDWADDLEQALMEADEEVAINGNQDYIADEEIVEWAAQYEERGPDGVDEELRR
VPFLETRAAAKEIGASIEFNKAEGIDSHDEAEPSDFIYFGISSLGGTMTDDQGELRFDEV
ETGVLYRAELEEGYDVSRLEPVVVGPNGSDSVSLLDESLINVDNVMVMDDGRVLLCEDKG
TFGRTYENDAMWVYEPPAVLRTDSIAVSHGATGEVDLTLSSIPDGLAGGRVTVSVEHADV
AAITDASYHDALELTSGPSIDGDGSSVEFRFADLEDEIGATLDDVTLATLDLEGVGTGTT
DITIEVHSLDDDDGLAIDTQPRPGIVVVGPPPVGEGSGRAPTDLDGDGLFEDVNGNGRLD
YQDVTLLFEHLEDDTVQLNEAAFDFNDNGRIDYDDIVALYDEL
Download sequence
Identical sequences D2RWD5
WP_012941845.1.92728 gi|284163918|ref|YP_003402197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]