SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284166318|ref|YP_003404597.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284166318|ref|YP_003404597.1|
Domain Number 1 Region: 33-325
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.66e-42
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284166318|ref|YP_003404597.1|
Sequence length 343
Comment hypothetical protein Htur_3058 [Haloterrigena turkmenica DSM 5511]
Sequence
MVTLYAAMRDRLRCYAGDDTEPGGTSHASTRLEGHRIECLAASRAAPDRVFVGTFEDGLY
RTRGQATEPGEREFERLETEFASEAVTALAISPHDPDVIYAGTEPSRVYRSTDGGDTWTH
LEGLTDLPSAGEWAFPPRPHTHHVRWLEVDPFDPDRLYVGIEAGAFVLSPDGGETWRERP
EGSRRDNHTLATHDDREGRVYTAAGDGYAVSDDGGDSWRRPQDGLEHTYCWGLAVDPADP
DAVIVSSASGARTAHTAERADTHVYRRLGDEPWARLEDRGLPTGEGVVRAVFETTGADGV
VYALNNWGLFRSEDFGDSWVGIDTDWTAGLETQAPRGLVAVSD
Download sequence
Identical sequences D2RYV6
WP_012944186.1.92728 gi|284166318|ref|YP_003404597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]