SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288559998|ref|YP_003423484.1| from Methanobrevibacter ruminantium M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288559998|ref|YP_003423484.1|
Domain Number 1 Region: 108-189
Classification Level Classification E-value
Superfamily EF-hand 0.0000078
Family Parvalbumin 0.092
Further Details:      
 
Weak hits

Sequence:  gi|288559998|ref|YP_003423484.1|
Domain Number - Region: 3-31
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0164
Family PhnA zinc-binding domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288559998|ref|YP_003423484.1|
Sequence length 240
Comment hypothetical protein mru_0741 [Methanobrevibacter ruminantium M1]
Sequence
MICPSCGSENKEGSKFCKNCGERLTDSSRPTSTNASASSQSKSNKNLLIICATIIICVAV
VAGAILFMSGQSTDYEVASGEATNDHSSSALNSYDSSNSNDESQDDSASASEDSSDSADE
YNKNHKWGKSFQEASEYFPEASETVVTHVFYEADIDGNGFLTDNEFKDFKSLVSFTRKYA
ADVTNNDYVDTPDLWEGDGSVRTRYCADHGRIAVGSDDRCPYCAKKGQDSRTRSGSTRYV
Download sequence
Identical sequences D3E231
WP_012955543.1.7700 gi|288559998|ref|YP_003423484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]