SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288560047|ref|YP_003423533.1| from Methanobrevibacter ruminantium M1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|288560047|ref|YP_003423533.1|
Domain Number - Region: 1-31
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0348
Family Ribosomal protein S27a 0.065
Further Details:      
 
Domain Number - Region: 188-275,313-341
Classification Level Classification E-value
Superfamily EF-hand 0.0511
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288560047|ref|YP_003423533.1|
Sequence length 347
Comment hypothetical protein mru_0790 [Methanobrevibacter ruminantium M1]
Sequence
MFCHNCGSEISDDANFCVNCGAKLIRLDEEKAQPSKSSSRGLSNKKTDEQKETSSGRGLF
NKKTDEQKETSSGRGLFNKKTKEQKEAIKEIKSYTKGNYKRFRQIIPRYGILAMEVSHTK
VFNGIIKTIRKEIENENLTADQIEGRVFQLLTEEYGEPMSQEEADELFNQQNLQTKLENE
RKLEQKFGVPFQNRVWFKCTVEEMRHSTFTNTNDRDIVDGYVFVEDTFLEIVKESVFLKS
KMGTRKIFYDNIASIDHDAKGRLNLSSSLEIYLKSSDRVQLKHVNKGMVDLVTGKYNEYM
ENKINDNAENVTNGTNSNVDELMKYADLYERGLLTQEEFEQKKKELL
Download sequence
Identical sequences D3E280
gi|288560047|ref|YP_003423533.1| WP_012955592.1.7700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]