SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288561428|ref|YP_003424914.1| from Methanobrevibacter ruminantium M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288561428|ref|YP_003424914.1|
Domain Number 1 Region: 117-176
Classification Level Classification E-value
Superfamily EF-hand 0.0000726
Family Calbindin D9K 0.06
Further Details:      
 
Weak hits

Sequence:  gi|288561428|ref|YP_003424914.1|
Domain Number - Region: 223-248
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000187
Family Transcriptional factor domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288561428|ref|YP_003424914.1|
Sequence length 264
Comment hypothetical protein mru_2172 [Methanobrevibacter ruminantium M1]
Sequence
MVKCSKCGSENKSEAKFCHSCGAKLDIKDPYNLDGKSREYGSTTGKSAGSASAYYDHSAN
SGGSSSDSTGGIDNFRNMSNFKKIIFACCAVFIVLFILSLAAQALGFDMEPYSENKTAYH
NYSSLDLDDDGALCLEELEIEYSNISSSKMSDIFKKSDKNRNHLIRGAEYDMLNYYVNEH
FKDLEKKKNEKTSSSSSSSSSSSGSSSYKSPFTTSGSSDDGAETCPFCGSEAVYESGNSY
KCAECGRTISNPDDLDLNYDEGYY
Download sequence
Identical sequences D3E1D7
WP_012956970.1.7700 gi|288561428|ref|YP_003424914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]