SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091000014m|PACid:23532948 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091000014m|PACid:23532948
Domain Number 1 Region: 66-176
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-31
Family B3 DNA binding domain 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091000014m|PACid:23532948
Sequence length 297
Sequence
MSINHYSPEARLYWSEQQQAATWLGNSHTPRFNLNDNQEEVEEEEEEVVVAAAAENGGGG
AAGEEKETMFEKPLTPSDVGKLNRLVIPKQHAEKHFPLESSSSSSSCGDSAKGVLLSFED
ESGKCWRFRYSYWNSSQSYVLTKGWSRYVKDKRLHAGDVVFFHRHRTHPQRFFITSTRRQ
ANPPAHVNSTATASFYSAQPYPAHHLPFPYQPLSLHAAPGGGSQGQNQTTPGGNSSGGRV
LRLFGVNMECQPHNDSQNSTPQCSYTLSSTLSHHHLHRQTSYSSSPNPHHHMLRQLP
Download sequence
Identical sequences V7D176
Phvulv091000014m|PACid:23532948 XP_007162942.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]