SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091000630m|PACid:23553293 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091000630m|PACid:23553293
Domain Number 1 Region: 127-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.19e-41
Family B3 DNA binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091000630m|PACid:23553293
Sequence length 706
Sequence
MPALIDLNSATEDHETPSSRPSSVCLELWHACAGPMISLPKKGTLVVYFPQGHLEQHLHD
FPLPASANIPSHLFCRVLDVKLHSEEGSDEVYCQVVLVPESEQGHQKLREGEIDADGEEE
DAEAVMKSTTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQELVAKDLH
GQEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSRDAVLFLRGEDGELRLGIRRAAQLKS
GSTISTFAGQQLNHSSLLDVVNALSARCAFSVHYNPRVSSSEFIIPIKKFLRSLDYSYSV
GTRFRMRFETEDAAERRFTGLIVGITDVDPVRWPGSKWRCLMVRWDDLEATRHNRVSPWE
IEPSGSASTANNMISAGLKRTKIGLPSTKLDFQVSNAIGASDFGESLRFQKVLQGQEMLG
VNTTFDSTNGQGHQLSDLRRCYPGSNCSRIAATGNSIGIPQVSSNVSCNGIGFSESFRFQ
KVLQGQEILPSQPYGRALSVDEACGNGRFGPFDGYHTLRSRNGWSSHLSNSSSHLHPPVP
SGQVSSPSSVLMFQQAHNPVSNSDYNSKISQVMEGKVQQRSSYTSEAKGGKFVSTPYEPL
RGLAQEGTNSYGVSNLHNQFETSRSHDSISALRATQELVPTCKSRCRVFGFSLTEGAPVA
SKEVAGTDPSAVTCSGPSFARHAEDDFHPVHSKAVGSYCTKGVLQY
Download sequence
Identical sequences V7CE54
XP_007156488.1.22112 Phvulv091000630m|PACid:23553293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]