SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091001133m|PACid:23538448 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091001133m|PACid:23538448
Domain Number 1 Region: 318-421
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.15e-18
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091001133m|PACid:23538448
Sequence length 906
Sequence
MESKNCMNVACATLTTIRWRKGWALRSGEFADLCDKCGSAYEQSTYCDMFHPNDSGWRKC
TSCDKRLHCGCIASMSQLELLDTGGVSCISCARNSGLQPIASNEKPNGSGTSKVIDASAQ
QCTTLANQLNVRGMQGGHYAENDGLRCWFKPHKVETDGLSTEMKPEVLPSVGELGSTLIS
QFHFESNGSSKASKAESCKVDSEMRDIYDSLAQTNLSMTLATPLGNSNPFHNSVVDEREQ
SKASSLLLGSRSRHLLPKPPRSTSGTGLEVNAGMISQIRVARPPAEGRGRNQLLPRYWPR
ITDQELQQISGDSNSTIVPLFEKMLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLRI
QDVKGKEWMFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRMDPEGKLIMGFRK
ATNSTAVQETLPSNMPNGSHSSETSYSGVYENLPVLSGYSGLLQSQKGCSETHLNVLSKK
WNSAGGDMNWHNIDMPESRKREGLPLPPLLVPEKKRTRNIGSKSKRMLIDSQDAMELKLT
WEEAQDLLRPPPTVKPSIVMIEDQVFEAYEEPPVFGKRSIFVVRSAGVNEQWTQCDSCSK
WRKLPVDVLIPPKWTCVENLWDQSRSSCAAPNELNPRELDNLLRLNKEFKKQRLAASQRP
ALDKESSGLDALANAAILGDDASDSGRTPVVTTTKHPRHRPGCSCIVCIQPPSGKGKHKP
TCTCNVCMTVKRRFKTLMMRKKKRQSEREAEIAQRNQLAWGTKEESEVDSTSRHLTPVDG
LENEVRAPIELEPRTEDHVAEAGKGQLDLNCQPDREEAQAGPNNVSMTTLLEEANLPLET
YLKQNGLTSLISEQQTNSASNVQAQTTNESEGRHNEDCGTPSVIHEQDSSHEENSGQDKD
QNNSLS
Download sequence
Identical sequences V7AQ41
XP_007134718.1.22112 XP_007134719.1.22112 Phvulv091001133m|PACid:23538448 Phvulv091001134m|PACid:23538447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]