SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091002158m|PACid:23557175 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091002158m|PACid:23557175
Domain Number 1 Region: 169-274
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-18
Family B3 DNA binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091002158m|PACid:23557175
Sequence length 387
Sequence
MDNFPDPVSATTTNPLILEQRSMGELNNVNFPVDNSGHVGFPDPYYAPFDQNMQFQQVNQ
YPLHTLQTGQPNAIYGAPNSEVQGWSQQQPEEEEYRKSVGTLTSKVARDKRKQVRQKSKS
VPVAPLVPTKGIIKEQPVPGGGSDGKLTINQDRIFAVFCSPDGKKLEEVFTKQLKNSDVS
VLGRIVLPKREVEAKLPPLTDKEGKDIMVKDVYSGMIWTLKYKYWSNNRSRMYVLENAGD
LVNHYELQMGDLITIYEDERKNLYVWARKKRNPEGAVSLSKKEVEDANNLLTSINGGGSS
PSGAKLGMNIAERDQLSNIAGNGAPSQTTIEATPPALPAPPALPAPFGGNNQWISDEDVY
GGLDNIFEIENSFHSFDHLKDYKTWPY
Download sequence
Identical sequences V7CPP8
XP_007159339.1.22112 Phvulv091002158m|PACid:23557175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]