SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091002159m|PACid:23557176 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091002159m|PACid:23557176
Domain Number 1 Region: 168-273
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-18
Family B3 DNA binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091002159m|PACid:23557176
Sequence length 386
Sequence
MDNFPDPVSATTTNPLILEQRSMGELNNVNFPVDNSGHVGFPDPYYAPFDQNMQFQQVNQ
YPLHTLQTGQPNAIYGAPNSEVQGWSQQQPEEEEYRKSVGTLTSKVARDKRKQVRQKSKS
VPVAPLVPTKGIIKEQPVPGGGSDGKLTINQDRIFAVFCSPDGKLEEVFTKQLKNSDVSV
LGRIVLPKREVEAKLPPLTDKEGKDIMVKDVYSGMIWTLKYKYWSNNRSRMYVLENAGDL
VNHYELQMGDLITIYEDERKNLYVWARKKRNPEGAVSLSKKEVEDANNLLTSINGGGSSP
SGAKLGMNIAERDQLSNIAGNGAPSQTTIEATPPALPAPPALPAPFGGNNQWISDEDVYG
GLDNIFEIENSFHSFDHLKDYKTWPY
Download sequence
Identical sequences V7CMB3
XP_007159338.1.22112 Phvulv091002159m|PACid:23557176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]