SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091002575m|PACid:23539363 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091002575m|PACid:23539363
Domain Number 1 Region: 107-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.41e-39
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 552-625
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000172
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091002575m|PACid:23539363
Sequence length 659
Sequence
MSLHRGEEDELYEQLWKACAGPHVEIPRAGQRVFYFPQGHMEQLEVSTNQELNQRIPLFK
LPSEILCRVVNVHLLAEQETDEVYAQITLVPENNQTEPTCPDPCPSEVPRPRVHSFCKVL
TASDTSTHGGFSVLRKHATECLPALDMSKSTPTQELVAKDLHGYEWRFKHIFRGQPRRHL
LTTGWSTFVTSKRLVAGDTFVFLRGSNGELRVGVRRLTPVQNSMPSSVISSQSMHLGVLA
TASHAVATQTLFVVYYKPRTSQFIVSVNKYLEAINQKCNVGMRLKTRSEGDDSTETDKRF
SGTIIGVEDISPHWVNSKWRSLKVQWDEPPSFPRPDRVSPWEIEPILASVPTTISSQPVV
IKNKRPRQASEVPDLGDTPLIAPTFWDAGLTQSDITQLGVMAESKRSESSAHMWHHNSSN
GISMNQIKASWLSCPSHLYLDTTDDSKSVSASPISKTHSERLNNDHCLDQVDKEISKVEP
ATGCRLFGIDLIDHTRSSSLSVDNASGVTSEGRTDVNHEPDISKASKGWKQEQLQVSPKE
TQSKQICSRSCTKVQMQGVAVGRAVDLTTLDGYEKLVDELEKMFDIKGQLRHRNKWEIVF
TDDEGDMMLVGDDPWPEFCNMVRRIFICSSQDVHKLSSGSKLPIFSTEEIVISSDTTEI
Download sequence
Identical sequences V7B7Q4
Phvulv091002575m|PACid:23539363 XP_007140507.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]