SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091002576m|PACid:23539364 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091002576m|PACid:23539364
Domain Number 1 Region: 107-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.84e-39
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091002576m|PACid:23539364
Sequence length 563
Sequence
MSLHRGEEDELYEQLWKACAGPHVEIPRAGQRVFYFPQGHMEQLEVSTNQELNQRIPLFK
LPSEILCRVVNVHLLAEQETDEVYAQITLVPENNQTEPTCPDPCPSEVPRPRVHSFCKVL
TASDTSTHGGFSVLRKHATECLPALDMSKSTPTQELVAKDLHGYEWRFKHIFRGQPRRHL
LTTGWSTFVTSKRLVAGDTFVFLRGSNGELRVGVRRLTPVQNSMPSSVISSQSMHLGVLA
TASHAVATQTLFVVYYKPRTSQFIVSVNKYLEAINQKCNVGMRLKTRSEGDDSTETDKRF
SGTIIGVEDISPHWVNSKWRSLKVQWDEPPSFPRPDRVSPWEIEPILASVPTTISSQPVV
IKNKRPRQASEVPDLGDTPLIAPTFWDAGLTQSDITQLGVMAESKRSESSAHMWHHNSSN
GISMNQIKASWLSCPSHLYLDTTDDSKSVSASPISKTHSERLNNDHCLDQVDKEISKVEP
ATGCRLFGIDLIDHTRSSSLSVDNASGVTSEGRTDVNHEPDISKASKGWKQEQLQVSPKE
TQSKQICSRSCTKVFDMSHVLII
Download sequence
Identical sequences V7B4J3
Phvulv091002576m|PACid:23539364 XP_007140506.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]