SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091004175m|PACid:23557431 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091004175m|PACid:23557431
Domain Number 1 Region: 113-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-29
Family B3 DNA binding domain 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091004175m|PACid:23557431
Sequence length 476
Sequence
MELMQEVKGYSDSREEEEEEEAAEEIITREDSSRLLHQHQDAAGSNFIISNHHHHHHHAT
KQLDFMDLTLGSSKDEGNLQGSGGGASSVFPHHASGSSSADGNVNSLQQPSEKEHMFDKV
VTPSDVGKLNRLVIPKQHAEKYFPLDSSANEKGLLLNFEDRNGKLWRFRYSYWNSSQSYV
MTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRPDHHHHHGPDPSTALFTPF
FLPNQPHFIRWGATGRLYTLPSPNPPRHHDHLQQHLNYNTMYHQHHHPFHHQLQAAAAGG
AAGGNGTHHYNYHDMSTSGSGSVYYLRSTPQPMPLTDHQILNTRQQQEGGNVSHPPIIID
SVPVAHHHHHQHHGGKSGSSTSTSPSTAGKRLRLFGVNMECASSTSEHPNCFSLLSSSSM
AHVTMANSNSPPSSSLPPLQLLREDSLSSPSSARFGDQRGEPSMLFDLDPSLQYRQ
Download sequence
Identical sequences V7ANU2
Phvulv091004175m|PACid:23557431 Phvulv091004176m|PACid:23557432 XP_007135337.1.22112 XP_007135338.1.22112 XP_007135339.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]