SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091004178m|PACid:23536274 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091004178m|PACid:23536274
Domain Number 1 Region: 99-164
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000392
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091004178m|PACid:23536274
Sequence length 189
Sequence
MQKILTSLEAEASTGFKSHSSCSTMSSRRSNGRASGRVALEKEVPLPQLPDHTTNLQWDE
VKPLSGKPYSHNILSPTNLCPRYYMWLASNLRLELPSCEVPTILTYMGKSWDMVYCGQNK
QQVFNVAGWKKFAVENCLRIGDACIFDLMESSDKKIIFEVQILRGDIPSEILENEMITGQ
SREMPIVLN
Download sequence
Identical sequences V7CKD2
Phvulv091004178m|PACid:23536274 XP_007157819.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]