SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Phvulv091004550m|PACid:23540227 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091004550m|PACid:23540227
Domain Number 1 Region: 208-321
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000235
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091004550m|PACid:23540227
Sequence length 323
Sequence
MQREKQNWSKVKGIAMEEKKFRGDGKKQVGNGDAWASMRKTVLAREENHFLYEDLSMEMR
ERSLKRNGKEVQSDYKPSKKIKSAEGCSRSNNDDVLRLCLTKRFGVFQHYDKEEEQEEEE
TNQNPHKRIKSKEGYSNSKSIFEYLLEAVSLFSEYEEEQNSLKNMHELRNNATVDDEEEE
NHESGELLPRQFQEKIQELNGSEVKFVTEKKLFSTDLNPKHARLSIPPTKIANRFLSETE
ESSLNECIKENGRLAGLSVTVLDPSLNECKMCLKKWKMERSYIYNLTKGWNQIVRHNHLQ
LHHTLHLWSFRVSSHLCFALVRI
Download sequence
Identical sequences Phvulv091004550m|PACid:23540227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]