SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091005530m|PACid:23542862 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091005530m|PACid:23542862
Domain Number 1 Region: 76-188
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-32
Family B3 DNA binding domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091005530m|PACid:23542862
Sequence length 353
Sequence
MSINHYSMELPETALWWPQQQQQPILMEPTPNPSSTSWPSADPLCLNLNNQNDDVEEDEE
EDRTTTTTQQEETEDEKEPMFEKPLTPSDVGKLNRLVIPKQHAEKYFPLSGGGGGDSGEC
KGLLLSFEDESGKCWRFRYSYWNSSQSYVLTKGWSRYVKDKRLDTGDVVLFERHRADAHR
LFIGWRRRRHGETSPVHVSSRAVGHGKSGNGNSKNEAAAATGGGLGWTRGFYSAHPYPTH
QQHLHNHQPLPYQYDCLHAGRGSEGQRERRRAVGKSGSGSSSSSSSSRVLRLFGVNMECE
AEDDSGPSTLECSYNSTNMPSTQGTQNPHHFYHPHPPQPQPHQILRHQPYYYY
Download sequence
Identical sequences V7BL55
XP_007145337.1.22112 Phvulv091005530m|PACid:23542862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]